Products

FGF-19 (Fibroblast growth factor-19), Human

FGF-19 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-19 is a specific ligand for FGF R4. Similarly, another FGF family member, FGF-7 (KGF), only activates KGF R, the IIIb isoform of FGF R2. During chick embryogenesis, FGF-19 has been shown to act synergistically with Wnt-8c to initiate inner ear development.
No. Size Price Qty Status
C01109-5UG 5 ug $108.00 Inquiry
C01109-20UG 20 ug $268.00 Inquiry
C01109-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGL
LQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLV
TGLEAVRSPSFEK with polyhistidine tag at the C-terminus

UnitProt ID:
O95750
 
Source:

Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <51 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for FGF-19 (Fibroblast growth factor-19), Human

Average Rating: 0 (0 Reviews )